PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_25870V3.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 202aa    MW: 21800.7 Da    PI: 4.4927
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_25870V3.6.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB712e-2256142490
              NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                        +d  lP a +++i+k++lP + +++kda++++ ec +efi +++se+++ c +++++ti+++ +l al  lGf +y+ ++++  +++
  Pp3c3_25870V3.6.p  56 DDVSLPKATMTKIIKEMLPPDVRVAKDAQDLLVECCVEFINLISSESNEICSKDEKRTIAPEHVLRALEILGFGEYIGEVQAAYEQH 142
                        6889*************************************************************************9998765555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-3754187IPR009072Histone-fold
SuperFamilySSF471134.35E-3356187IPR009072Histone-fold
PfamPF008082.2E-2159123IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MIVAQYVHLT KYICCKIQDF GFSDLTNIGS NVIDSCLNCY SGVFEAMDTA GSRPKDDVSL  60
PKATMTKIIK EMLPPDVRVA KDAQDLLVEC CVEFINLISS ESNEICSKDE KRTIAPEHVL  120
RALEILGFGE YIGEVQAAYE QHKNESLESP KVGGRWAKEG GGGGMTEEEA IAAQQRMFAE  180
ARARMNSGGA AAPAAQANDS D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-385618212133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001780865.11e-111predicted protein
SwissprotP495922e-71NC2B_ARATH; Protein Dr1 homolog
TrEMBLA9TQH01e-111A9TQH0_PHYPA; Predicted protein
STRINGPP1S288_38V6.11e-111(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP34491727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.43e-62nuclear factor Y, subunit B13